PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010551469.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 142aa    MW: 16215.4 Da    PI: 9.8693
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010551469.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41e-15652147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r++WT+eE+ +++++  +lG+g+W++I+r    +Rt+ q+ s+ qky
   XP_010551469.1  6 RNPWTEEEHMRFLRGLDELGKGDWRAISRNYVVTRTPTQVASHAQKY 52
                     79********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.006157IPR017930Myb domain
SMARTSM007175.8E-11555IPR001005SANT/Myb domain
SuperFamilySSF466892.58E-16557IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-18655IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-11651IPR009057Homeodomain-like
PfamPF002491.6E-13652IPR001005SANT/Myb domain
CDDcd001678.52E-11853No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MRGTSRNPWT EEEHMRFLRG LDELGKGDWR AISRNYVVTR TPTQVASHAQ KYFLRLNCLN  60
NRRRRGSSLF DITIDSVTIS RQEKPMVFPV IGESSQTPIR MFQPPVLRIS DLSLNDRPPE  120
LFLSLAMPSS PSSSDEPNPV DA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010551469.11e-101PREDICTED: transcription factor MYB1R1 isoform X1
SwissprotQ2V9B08e-25MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLV7CAD34e-33V7CAD3_PHAVU; Uncharacterized protein
STRINGPOPTR_0012s05720.15e-29(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2047755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.22e-26MYB_related family protein